PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kaladp0040s0153.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family WRKY
Protein Properties Length: 215aa    MW: 24174.9 Da    PI: 8.5788
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kaladp0040s0153.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY1023.4e-32130188159
                          ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                 WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                          ldDgy+WrKYGqK vk+++fprsYYrCt++gC+vkk+++r ++d+ vv++tYeg H h+
  Kaladp0040s0153.1.p 130 LDDGYRWRKYGQKAVKNNKFPRSYYRCTHQGCNVKKQIQRVSKDEGVVITTYEGFHSHP 188
                          59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.807.8E-33115189IPR003657WRKY domain
SuperFamilySSF1182907.19E-29122189IPR003657WRKY domain
PROSITE profilePS5081129.539125190IPR003657WRKY domain
SMARTSM007741.7E-37130189IPR003657WRKY domain
PfamPF031063.1E-26131188IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 215 aa     Download sequence    Send to blast
MFMAFDQISN SASSRHVSLA SIIPVSASES QLFKSHMTTG STLAPGLMEQ QQQQERGVKR  60
PSLDESSDNN CENNNESGCI DAQSCDSVVG MKQQISNAAA TSDQGVEKEE KKKKKKHRYA  120
FQTRSHVDIL DDGYRWRKYG QKAVKNNKFP RSYYRCTHQG CNVKKQIQRV SKDEGVVITT  180
YEGFHSHPTI QNSSDNFEHI LTQMNIYNNN CSPL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2lex_A1e-27120187774Probable WRKY transcription factor 4
1wj2_A1e-27120187774Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009343134.17e-59PREDICTED: probable WRKY transcription factor 75
TrEMBLW8E2P51e-58W8E2P5_MALBA; WRKY75
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13080.12e-52WRKY DNA-binding protein 75